PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0243s0016.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 342aa    MW: 37398.9 Da    PI: 8.4628
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0243s0016.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.53.8e-32172228158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR+Rg+gGrF
  Kalax.0243s0016.3.p 172 QEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHQHAIRRARGTGGRF 228
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.3E-35170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.866171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-27173228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-24174196IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860176196IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-24205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGHGNMPTKP EKPSIDLHGN PSPAVYSEPW WCSAGYNQAP SVVATGNAGY QPSRNLESNT  60
VQSFSTGGPN EDEDDNDVSK KSMQDAGRQR ERSPHRDGNN IMPGAPTSGA DNCITQHPQL  120
ELVGHTMACA PNPYQDPYYG GMMAAYGPQP VIYPHPLGPN HARMPLPLEV AQEPVYVNAK  180
QYHGILRRRQ SRAKAELEKK LIKVRKPYLH ESRHQHAIRR ARGTGGRFAK KTDAENGGPA  240
AAQSVSSSGS ELMPSDSAET WNSHRCRFED PKGSSQSQMH NEHHKQTNSD QNGGGYGNSS  300
AFRPTSYHSG SRNEENDCSS QQWGSIASNN QVTSQRRFAI Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-19172228258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006470622.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006470621.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006470620.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006470619.11e-100PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_006446128.11e-100hypothetical protein CICLE_v10015808mg
RefseqXP_006446127.11e-100hypothetical protein CICLE_v10015808mg
RefseqXP_006446126.11e-100hypothetical protein CICLE_v10015808mg
RefseqXP_006446125.11e-100hypothetical protein CICLE_v10015808mg
SwissprotQ9LXV54e-63NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A067F5721e-100A0A067F572_CITSI; Uncharacterized protein
TrEMBLV4U5J81e-100V4U5J8_9R
STRINGGLYMA08G45030.12e-86(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.41e-64nuclear factor Y, subunit A1